Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333656.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
GTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEPLNADQAFKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIALFDANVLAVLSEVMSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEA AAIMEHILDGSAYVKAAEKLHETDPLQKPKQDRYALRTSPQWLGPQIEVIRTATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNARLAIASIGKLLFAQFSELVNDFYNN GLASNLSGGRKPELGLWAQR | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 11,347.002 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 18.566 | ||
aromaticity | 0.070 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.333 | ||
sheet | 0.307 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333656.1 | 3prime_partial | 114 | 344-3(-) |
Amino Acid sequence : | |||
MVLQLMRQVIGEFGFPVHHFGENGGHNFRQNSKNVGVEESNRGQPGADGGAVDEGEAFLGLEFEEAAVDAGELEGLVGVEGFAGGADGFGVGAAGEEAGDVGQGDQVAGGGDGA | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 11,347.002 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 18.566 | ||
aromaticity | 0.070 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.333 | ||
sheet | 0.307 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333656.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
GTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEPLNADQAFKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIALFDANVLAVLSEVMSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEA AAIMEHILDGSAYVKAAEKLHETDPLQKPKQDRYALRTSPQWLGPQIEVIRTATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNARLAIASIGKLLFAQFSELVNDFYNN GLASNLSGGRKPELGLWAQR | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 11,347.002 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 18.566 | ||
aromaticity | 0.070 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.333 | ||
sheet | 0.307 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333656.1 | 3prime_partial | 114 | 344-3(-) |
Amino Acid sequence : | |||
MVLQLMRQVIGEFGFPVHHFGENGGHNFRQNSKNVGVEESNRGQPGADGGAVDEGEAFLGLEFEEAAVDAGELEGLVGVEGFAGGADGFGVGAAGEEAGDVGQGDQVAGGGDGA | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 11,347.002 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 18.566 | ||
aromaticity | 0.070 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.333 | ||
sheet | 0.307 |