| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333659.1 | internal | 272 | 818-3(-) |
Amino Acid sequence : | |||
| GEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTV EYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIV ANGLARRCIVQVSYAIGVPEPLSVFVDSYGTG | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 16,392.238 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 97.221 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
| Helix | 0.131 | ||
| turn | 0.488 | ||
| sheet | 0.119 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333659.1 | 5prime_partial | 178 | 3-539(+) |
Amino Acid sequence : | |||
| PRPVGVHKHRQRLRDTDGVRDLHDAPPCEPVGNDALGRLPDNVGSTPVDLGRVLPGEGPAAVGPPPAVGVDDDLTAGETRVAMGPTDDETPGGIKVEDGFLVQILLGDDRLDDMLLEIPG DLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPIGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 16,392.238 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 97.221 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
| Helix | 0.131 | ||
| turn | 0.488 | ||
| sheet | 0.119 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333659.1 | 3prime_partial | 160 | 481-2(-) |
Amino Acid sequence : | |||
| MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPTAAGPSPGRTLPRSTGVEPTLS GRRPRASLPTGSQGGASCKSRTPSVSLSRCLCLWTPTGRG | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 16,392.238 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 97.221 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
| Helix | 0.131 | ||
| turn | 0.488 | ||
| sheet | 0.119 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333659.1 | internal | 272 | 818-3(-) |
Amino Acid sequence : | |||
| GEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTV EYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIV ANGLARRCIVQVSYAIGVPEPLSVFVDSYGTG | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 16,392.238 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 97.221 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
| Helix | 0.131 | ||
| turn | 0.488 | ||
| sheet | 0.119 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333659.1 | 5prime_partial | 178 | 3-539(+) |
Amino Acid sequence : | |||
| PRPVGVHKHRQRLRDTDGVRDLHDAPPCEPVGNDALGRLPDNVGSTPVDLGRVLPGEGPAAVGPPPAVGVDDDLTAGETRVAMGPTDDETPGGIKVEDGFLVQILLGDDRLDDMLLEIPG DLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPIGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 16,392.238 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 97.221 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
| Helix | 0.131 | ||
| turn | 0.488 | ||
| sheet | 0.119 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333659.1 | 3prime_partial | 160 | 481-2(-) |
Amino Acid sequence : | |||
| MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPTAAGPSPGRTLPRSTGVEPTLS GRRPRASLPTGSQGGASCKSRTPSVSLSRCLCLWTPTGRG | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 16,392.238 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 97.221 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
| Helix | 0.131 | ||
| turn | 0.488 | ||
| sheet | 0.119 | ||