| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333670.1 | internal | 191 | 3-575(+) |
Amino Acid sequence : | |||
| GWPFIGRLRVCFSSPPYFQMTVKPMFTHGLDVTELPGIAGWIDNLLALVFEQTLVEPNMLVVDVEKFASPQPGEWFSVDAKEPVALAIVEILEATEMKPSDLNGLADPYIKGQLGPNKFR TRTQKKTLSPKWHEEFKIPIFTWESDNMLGIEVRDKDRVFDDMMGDCSININEYKDGQRHDMWLPLKNIKM | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,917.095 | ||
| Theoretical pI: | 5.026 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37595 | ||
| Instability index: | 38.262 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.225 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333670.1 | internal | 191 | 3-575(+) |
Amino Acid sequence : | |||
| GWPFIGRLRVCFSSPPYFQMTVKPMFTHGLDVTELPGIAGWIDNLLALVFEQTLVEPNMLVVDVEKFASPQPGEWFSVDAKEPVALAIVEILEATEMKPSDLNGLADPYIKGQLGPNKFR TRTQKKTLSPKWHEEFKIPIFTWESDNMLGIEVRDKDRVFDDMMGDCSININEYKDGQRHDMWLPLKNIKM | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,917.095 | ||
| Theoretical pI: | 5.026 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37595 | ||
| Instability index: | 38.262 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.225 | ||
| sheet | 0.251 | ||