| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333672.1 | internal | 228 | 1-684(+) |
Amino Acid sequence : | |||
| KTLTMDEDFDMPAAGEMEEDMDLPDAGSYLKVGEEKEIDPQGLKKKLVKEGEGWETPESGDEVQVHYTGTLLDGTKFDSSRDRGEPFKFTLGQGQVIKGWDLGIKTMKKGENAIFTIPAA LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKIVKEGEKWENPKDPDEVLVNYKAMLEDGTVVSQAEGVEFTVEEGHFCPALAKAVKTMKKGEEVLLT | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 25,035.042 | ||
| Theoretical pI: | 4.563 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 27.981 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.505 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.219 | ||
| sheet | 0.285 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333672.1 | internal | 228 | 1-684(+) |
Amino Acid sequence : | |||
| KTLTMDEDFDMPAAGEMEEDMDLPDAGSYLKVGEEKEIDPQGLKKKLVKEGEGWETPESGDEVQVHYTGTLLDGTKFDSSRDRGEPFKFTLGQGQVIKGWDLGIKTMKKGENAIFTIPAA LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKIVKEGEKWENPKDPDEVLVNYKAMLEDGTVVSQAEGVEFTVEEGHFCPALAKAVKTMKKGEEVLLT | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 25,035.042 | ||
| Theoretical pI: | 4.563 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 27.981 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.505 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.219 | ||
| sheet | 0.285 | ||