Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333676.1 | 5prime_partial | 118 | 1-357(+) |
Amino Acid sequence : | |||
EALTYRVGHHSTSDDSTKYRSMNEIEHWRTARSPMTRFRKWVQRNNWWSDDQEAEHRRTTRKQVLKAIQAAEKTEKPGLEDMFKDVYEEVPRNLQEQERFLRETIKRHQQDFPADMPV* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 14,373.823 | ||
Theoretical pI: | 8.310 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26470 | ||
Instability index: | 57.031 | ||
aromaticity | 0.093 | ||
GRAVY | -1.390 | ||
Secondary Structure Fraction | |||
Helix | 0.212 | ||
turn | 0.144 | ||
sheet | 0.246 |