| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333681.1 | 5prime_partial | 264 | 880-86(-) |
Amino Acid sequence : | |||
| GFGSDTGWMCQKLCISFASWEYAVFSADILGHGRSDGIRGYIGDMNKVAAASLSFFRSVRVSEEYKDLPAFLVGESMGGLLSMLMYLQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHVFM YGLLFGLAVTWAAMPDKKMVGMAIKDPEKLKVIASTPMRYTGKPRVGPMRELVRQTDYVQRNFDKVKVPFLVLHGTLDGLVEVSGSEMLYQKASSEDKTLKLYEGMYHSLVQGEPDENAN LVLPDMRAWIDPRVERYGSNCSAH* | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 19,735.671 | ||
| Theoretical pI: | 9.611 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 43.942 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.247 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333681.1 | 5prime_partial | 170 | 2-514(+) |
Amino Acid sequence : | |||
| SFFLYFNMRNTVKENRDCVKNHPMLREWLMCTTVGTISLNSRINPGPHIRQHKISILIGLTLHQRVIHPFIQFQSLVLTAGLLVQHLRPRHFNQPIQGPVQNQEGHLDLVEIPLHVIRLP YQLPHWPHSGLPSVPHRGARDYLQLLRIFDGHPHHLLVRHCSPCDGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,735.671 | ||
| Theoretical pI: | 9.611 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 43.942 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.247 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333681.1 | 5prime_partial | 264 | 880-86(-) |
Amino Acid sequence : | |||
| GFGSDTGWMCQKLCISFASWEYAVFSADILGHGRSDGIRGYIGDMNKVAAASLSFFRSVRVSEEYKDLPAFLVGESMGGLLSMLMYLQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHVFM YGLLFGLAVTWAAMPDKKMVGMAIKDPEKLKVIASTPMRYTGKPRVGPMRELVRQTDYVQRNFDKVKVPFLVLHGTLDGLVEVSGSEMLYQKASSEDKTLKLYEGMYHSLVQGEPDENAN LVLPDMRAWIDPRVERYGSNCSAH* | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 19,735.671 | ||
| Theoretical pI: | 9.611 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 43.942 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.247 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333681.1 | 5prime_partial | 170 | 2-514(+) |
Amino Acid sequence : | |||
| SFFLYFNMRNTVKENRDCVKNHPMLREWLMCTTVGTISLNSRINPGPHIRQHKISILIGLTLHQRVIHPFIQFQSLVLTAGLLVQHLRPRHFNQPIQGPVQNQEGHLDLVEIPLHVIRLP YQLPHWPHSGLPSVPHRGARDYLQLLRIFDGHPHHLLVRHCSPCDGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,735.671 | ||
| Theoretical pI: | 9.611 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 43.942 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.247 | ||
| sheet | 0.194 | ||