| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333684.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| GASLFEELGIYYIGPVDGHSVEDLVYIFKKVKEMPAPGPVLIHIITEKGKGYPPAEVAADKMHGVVKFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAMGGGTGLNIFQ KRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCTIYSSFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMVATAAVIDDRPSCVRY PRGNGVXAALP | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 21,896.927 | ||
| Theoretical pI: | 6.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 57.714 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.208 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333684.1 | complete | 192 | 585-7(-) |
Amino Acid sequence : | |||
| MCGPIRPHQSSSIHHEPHRKLLEVHVMHHLIVPSLQERRVDRAEWLQPFCGEACSEGDSVLLGDPHVEATVREALLEDVETGSAAHGRVDSDYFVVLLRFGDEGLGEVLCVGFCACFGLH LFPGCWIELHHTMHFICSNFSRRIAFALLRDDVDQHGSRRRHLLNFLENINKIFHTMPINRSDVINPKLLKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 21,896.927 | ||
| Theoretical pI: | 6.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 57.714 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.208 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333684.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| GASLFEELGIYYIGPVDGHSVEDLVYIFKKVKEMPAPGPVLIHIITEKGKGYPPAEVAADKMHGVVKFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAMGGGTGLNIFQ KRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCTIYSSFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMVATAAVIDDRPSCVRY PRGNGVXAALP | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 21,896.927 | ||
| Theoretical pI: | 6.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 57.714 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.208 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333684.1 | complete | 192 | 585-7(-) |
Amino Acid sequence : | |||
| MCGPIRPHQSSSIHHEPHRKLLEVHVMHHLIVPSLQERRVDRAEWLQPFCGEACSEGDSVLLGDPHVEATVREALLEDVETGSAAHGRVDSDYFVVLLRFGDEGLGEVLCVGFCACFGLH LFPGCWIELHHTMHFICSNFSRRIAFALLRDDVDQHGSRRRHLLNFLENINKIFHTMPINRSDVINPKLLKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 21,896.927 | ||
| Theoretical pI: | 6.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 57.714 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.208 | ||
| sheet | 0.260 | ||