Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333687.1	5prime_partial	215	2-649(+)
Amino Acid sequence :
LHWLSQIPKEVMEKGSAAYNEGRVTIHGAKEGTVNAYKKQFQSDLVAFLRSRSKELKPGGSMFLMLLGRTSPDPEDQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPGLEE FKEVVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGHELFSRLLSRAVAQAKELMDLFQLVHIVASLTLA*
Physicochemical properties
Number of amino acids:		215
Molecular weight:		23,904.963
Theoretical pI:		5.529
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23950 23950
Instability index:		40.493
aromaticity		0.084
GRAVY		-0.132
Secondary Structure Fraction
Helix		0.330
turn		0.219
sheet		0.293