| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333694.1 | internal | 286 | 3-860(+) |
Amino Acid sequence : | |||
| IRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQS FDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVL GKQSVTESNLHQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGG | |||
Physicochemical properties | |||
| Number of amino acids: | 286 | ||
| Molecular weight: | 19,503.294 | ||
| Theoretical pI: | 6.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 45.297 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.040 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.179 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333694.1 | 3prime_partial | 173 | 521-3(-) |
Amino Acid sequence : | |||
| MLFAVFSHDFPSLLDIIIVEKCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHL LLPHPAVVVHHLVGEKWEGHYAPHLAPVLPVHREHHVLPVAREYVEHHVARPD | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,503.294 | ||
| Theoretical pI: | 6.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 45.297 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.040 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.179 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333694.1 | internal | 286 | 3-860(+) |
Amino Acid sequence : | |||
| IRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQS FDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVL GKQSVTESNLHQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGG | |||
Physicochemical properties | |||
| Number of amino acids: | 286 | ||
| Molecular weight: | 19,503.294 | ||
| Theoretical pI: | 6.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 45.297 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.040 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.179 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333694.1 | 3prime_partial | 173 | 521-3(-) |
Amino Acid sequence : | |||
| MLFAVFSHDFPSLLDIIIVEKCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHL LLPHPAVVVHHLVGEKWEGHYAPHLAPVLPVHREHHVLPVAREYVEHHVARPD | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,503.294 | ||
| Theoretical pI: | 6.160 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 45.297 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.040 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.179 | ||
| sheet | 0.289 | ||