Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333697.1 | complete | 171 | 281-796(+) |
Amino Acid sequence : | |||
MKGGRKNLKRAVEAEMATLQQGETIMQVVDLRGSNLIEVRDNKGHHLLAIFPAKFQKSMWIKRGNFVVVDESGREEAIESGRKVAGMVTQVLYHDQVRLLQKSSEWPDIFKSSTEETSKP CLHFSTSQKDDECSSDDEEGLPPLEANTNRVNPLLHLDVEATTESDSENDS* | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 12,007.236 | ||
Theoretical pI: | 9.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 64.437 | ||
aromaticity | 0.143 | ||
GRAVY | -0.543 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.324 | ||
sheet | 0.114 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333697.1 | complete | 108 | 748-422(-) |
Amino Acid sequence : | |||
MQQRIYPVCIRFQRRKSLFVITRAFIVFLGGREMQTRLRRLFSRRFENIRPFRRFLEKTNLVMVKYLCNHACYLSTRFDCLFSPTLINYNKIATFNPHALLEFCWKYC* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,007.236 | ||
Theoretical pI: | 9.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 64.437 | ||
aromaticity | 0.143 | ||
GRAVY | -0.543 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.324 | ||
sheet | 0.114 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333697.1 | 5prime_partial | 105 | 873-556(-) |
Amino Acid sequence : | |||
FSKMCSNFVFHIISSRSKNTIKMHKDYESFSLSDSVVASTSKCNRGFTRFVFASKGGSPSSSSLEHSSSFWEVEKCKQGFDVSSVDDLKISGHSEDFWRRRTWSW* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,007.236 | ||
Theoretical pI: | 9.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 64.437 | ||
aromaticity | 0.143 | ||
GRAVY | -0.543 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.324 | ||
sheet | 0.114 |