| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333705.1 | 5prime_partial | 250 | 1-753(+) |
Amino Acid sequence : | |||
| LLKRSGLKNPNIGRNLHLHPVVMGWGYFPDTWPEANKRSYEGGIMTAMTRVNTHSIIQTPALHPGMFSALMPWVSGQDIKARMLKFSRTAHVFALARDKGSGIVTSPTHISYKMDSFDKL NLTKGVSQVLRVLAAAGAEEIGTHHTRGRVLRVKEASEEEFERFVEEESSRAVEEMSNPMCSAHQMGSCRMGVGPEASAVGPTGETWEVEGLYVADSSVFPSALGVNPMVTIQAIAYCIA QSLVQAMPNY* | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 11,571.010 | ||
| Theoretical pI: | 9.560 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
| Instability index: | 118.421 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
| Helix | 0.164 | ||
| turn | 0.500 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333705.1 | complete | 110 | 592-260(-) |
Amino Acid sequence : | |||
| MPRAPHPSCSSPSGGLSTWGSTFPPPPASSPPPRTSQTPPHSPPSPSEPAPACGGSRFPQHRRPPAHAGLGSPLWLGLACRSYPSCSLCEWERSLSPNLCPLLGQIRGRF* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,571.010 | ||
| Theoretical pI: | 9.560 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
| Instability index: | 118.421 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
| Helix | 0.164 | ||
| turn | 0.500 | ||
| sheet | 0.191 | ||