Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333705.1 | 5prime_partial | 250 | 1-753(+) |
Amino Acid sequence : | |||
LLKRSGLKNPNIGRNLHLHPVVMGWGYFPDTWPEANKRSYEGGIMTAMTRVNTHSIIQTPALHPGMFSALMPWVSGQDIKARMLKFSRTAHVFALARDKGSGIVTSPTHISYKMDSFDKL NLTKGVSQVLRVLAAAGAEEIGTHHTRGRVLRVKEASEEEFERFVEEESSRAVEEMSNPMCSAHQMGSCRMGVGPEASAVGPTGETWEVEGLYVADSSVFPSALGVNPMVTIQAIAYCIA QSLVQAMPNY* | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 11,571.010 | ||
Theoretical pI: | 9.560 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
Instability index: | 118.421 | ||
aromaticity | 0.064 | ||
GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
Helix | 0.164 | ||
turn | 0.500 | ||
sheet | 0.191 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333705.1 | complete | 110 | 592-260(-) |
Amino Acid sequence : | |||
MPRAPHPSCSSPSGGLSTWGSTFPPPPASSPPPRTSQTPPHSPPSPSEPAPACGGSRFPQHRRPPAHAGLGSPLWLGLACRSYPSCSLCEWERSLSPNLCPLLGQIRGRF* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,571.010 | ||
Theoretical pI: | 9.560 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
Instability index: | 118.421 | ||
aromaticity | 0.064 | ||
GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
Helix | 0.164 | ||
turn | 0.500 | ||
sheet | 0.191 |