| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333717.1 | internal | 283 | 1-849(+) |
Amino Acid sequence : | |||
| ALTHTQRAKMDPVSEWGNSSLSAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTRWGVNVQPYSGSPANF AAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLIICGGSAYPRDWDYKRFREIADKVGALLLCDMAHISGLVAAQEAADP FEYCDIVTTTTHKSLRGPRAGMIFYRKGPKPPQKGQPEDAVYD | |||
Physicochemical properties | |||
| Number of amino acids: | 283 | ||
| Molecular weight: | 19,830.536 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 84.868 | ||
| aromaticity | 0.012 | ||
| GRAVY | -1.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.251 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333717.1 | 5prime_partial | 192 | 2-580(+) |
Amino Acid sequence : | |||
| HSHTHRERKWIQSQSGATPRSPPWTPRSTTSSRRRSAANAAASSSSPQRTSPPSPSSRPSAAPSPTSTPRACRATATTVATNSSTRSRTSRAHAPSRPTASTPPAGASTSSPTAALRPTS PPTPPSSTPTTASWASICPPAATSPTDTTHPAGRRSVRPRFISRACLIRWIRRLDTSITSDWRRRRWISALN* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 19,830.536 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 84.868 | ||
| aromaticity | 0.012 | ||
| GRAVY | -1.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.251 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333717.1 | 5prime_partial | 190 | 849-277(-) |
Amino Acid sequence : | |||
| IVNGVFWLPFLGWLRTLTVEDHASSRTPQALVGCCCDDVAVLERIGCFLSSNESTNMRHITQQQSSNLISDLPKPLIIPIPRVRAPATYNQFRAEIQRLLLQSLVIDVSSLRIHLIRQAL EINRGRTDLLPAGCVVSVGEVAAGGQIEAHDAVVGVEDGGVGGEVGRRAAVGLDVDAPAGGVEAVGLEGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 19,830.536 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 84.868 | ||
| aromaticity | 0.012 | ||
| GRAVY | -1.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.251 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333717.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
| THTHTESENGSSLRVGQLLALRRGPRDPRPHREGEAPPMPRHRAHRLRELHLLRRHRGPRQRPHQQVLRGHAGQPLLRWQRIHRRDREPHALTRPPGLPPRPHPLGRQRPALQRLSGQLR RLHRRPQPPRPHHGPRSALRRPPHPRILHIRREEDQCDLDLFRELAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,830.536 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 84.868 | ||
| aromaticity | 0.012 | ||
| GRAVY | -1.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.251 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333717.1 | internal | 283 | 1-849(+) |
Amino Acid sequence : | |||
| ALTHTQRAKMDPVSEWGNSSLSAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTRWGVNVQPYSGSPANF AAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLIICGGSAYPRDWDYKRFREIADKVGALLLCDMAHISGLVAAQEAADP FEYCDIVTTTTHKSLRGPRAGMIFYRKGPKPPQKGQPEDAVYD | |||
Physicochemical properties | |||
| Number of amino acids: | 283 | ||
| Molecular weight: | 19,830.536 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 84.868 | ||
| aromaticity | 0.012 | ||
| GRAVY | -1.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.251 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333717.1 | 5prime_partial | 192 | 2-580(+) |
Amino Acid sequence : | |||
| HSHTHRERKWIQSQSGATPRSPPWTPRSTTSSRRRSAANAAASSSSPQRTSPPSPSSRPSAAPSPTSTPRACRATATTVATNSSTRSRTSRAHAPSRPTASTPPAGASTSSPTAALRPTS PPTPPSSTPTTASWASICPPAATSPTDTTHPAGRRSVRPRFISRACLIRWIRRLDTSITSDWRRRRWISALN* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 19,830.536 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 84.868 | ||
| aromaticity | 0.012 | ||
| GRAVY | -1.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.251 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333717.1 | 5prime_partial | 190 | 849-277(-) |
Amino Acid sequence : | |||
| IVNGVFWLPFLGWLRTLTVEDHASSRTPQALVGCCCDDVAVLERIGCFLSSNESTNMRHITQQQSSNLISDLPKPLIIPIPRVRAPATYNQFRAEIQRLLLQSLVIDVSSLRIHLIRQAL EINRGRTDLLPAGCVVSVGEVAAGGQIEAHDAVVGVEDGGVGGEVGRRAAVGLDVDAPAGGVEAVGLEGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 19,830.536 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 84.868 | ||
| aromaticity | 0.012 | ||
| GRAVY | -1.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.251 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333717.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
| THTHTESENGSSLRVGQLLALRRGPRDPRPHREGEAPPMPRHRAHRLRELHLLRRHRGPRQRPHQQVLRGHAGQPLLRWQRIHRRDREPHALTRPPGLPPRPHPLGRQRPALQRLSGQLR RLHRRPQPPRPHHGPRSALRRPPHPRILHIRREEDQCDLDLFRELAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,830.536 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 84.868 | ||
| aromaticity | 0.012 | ||
| GRAVY | -1.400 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.251 | ||
| sheet | 0.251 | ||