| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333718.1 | 5prime_partial | 163 | 549-58(-) |
Amino Acid sequence : | |||
| INQKIQTTHILGFITRQIQLRCRHIIRRQLHSFQVIKEIRHPLIAALQEFPRHRGSHDVRRDAVHADAVPPQLHGGVLHQPHHAVFRRGVRVGADTAQHAGVGRRRDDAPPPLGDHHPGG VFRPQKHAGEVHADDAVEFRQREVGEQLELRRLEDAGVVVHDV* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 11,798.609 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 63.548 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333718.1 | 5prime_partial | 153 | 1-462(+) |
Amino Acid sequence : | |||
| TQESDVEAAVNAAVKTHGTLDIMYNNAGILESPQFKLLSDFPLSEFNRVVGVNLAGVFLGTKHAARVMIPKRRGSIISTATDASVLGGVGAHAYTAAKHGVVGLMKNAAVELGRHGVRVN CVSPYIVATPMSRKFLESSDEGMTDFFYNLKGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 11,798.609 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 63.548 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333718.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
| PGIRRGSRRQRRRQNSRNPRHHVQQRRHPRVAAIQAALRLPAVGIQPRRRREPRRRVSGDETRRQGDDPQAAGEHHLDGDRRQRAGRCRRPRVHRGETRRGGADEERRRGAGEARRPREL RLAVHRGYPDVEEILGEQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 11,798.609 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 63.548 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333718.1 | complete | 109 | 377-48(-) |
Amino Acid sequence : | |||
| MYGETQFTRTPCLPSSTAAFFISPTTPCFAAVYAWAPTPPSTLASVAVEMMLPRRLGIITLAACFVPRNTPARFTPTTRLNSDSGKSESSLNCGDSRMPALLYMMSRVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,798.609 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 63.548 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333718.1 | 5prime_partial | 163 | 549-58(-) |
Amino Acid sequence : | |||
| INQKIQTTHILGFITRQIQLRCRHIIRRQLHSFQVIKEIRHPLIAALQEFPRHRGSHDVRRDAVHADAVPPQLHGGVLHQPHHAVFRRGVRVGADTAQHAGVGRRRDDAPPPLGDHHPGG VFRPQKHAGEVHADDAVEFRQREVGEQLELRRLEDAGVVVHDV* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 11,798.609 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 63.548 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333718.1 | 5prime_partial | 153 | 1-462(+) |
Amino Acid sequence : | |||
| TQESDVEAAVNAAVKTHGTLDIMYNNAGILESPQFKLLSDFPLSEFNRVVGVNLAGVFLGTKHAARVMIPKRRGSIISTATDASVLGGVGAHAYTAAKHGVVGLMKNAAVELGRHGVRVN CVSPYIVATPMSRKFLESSDEGMTDFFYNLKGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 11,798.609 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 63.548 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333718.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
| PGIRRGSRRQRRRQNSRNPRHHVQQRRHPRVAAIQAALRLPAVGIQPRRRREPRRRVSGDETRRQGDDPQAAGEHHLDGDRRQRAGRCRRPRVHRGETRRGGADEERRRGAGEARRPREL RLAVHRGYPDVEEILGEQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 11,798.609 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 63.548 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333718.1 | complete | 109 | 377-48(-) |
Amino Acid sequence : | |||
| MYGETQFTRTPCLPSSTAAFFISPTTPCFAAVYAWAPTPPSTLASVAVEMMLPRRLGIITLAACFVPRNTPARFTPTTRLNSDSGKSESSLNCGDSRMPALLYMMSRVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,798.609 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 63.548 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.294 | ||
| sheet | 0.275 | ||