Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333718.1 | 5prime_partial | 163 | 549-58(-) |
Amino Acid sequence : | |||
INQKIQTTHILGFITRQIQLRCRHIIRRQLHSFQVIKEIRHPLIAALQEFPRHRGSHDVRRDAVHADAVPPQLHGGVLHQPHHAVFRRGVRVGADTAQHAGVGRRRDDAPPPLGDHHPGG VFRPQKHAGEVHADDAVEFRQREVGEQLELRRLEDAGVVVHDV* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 11,798.609 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 63.548 | ||
aromaticity | 0.092 | ||
GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.294 | ||
sheet | 0.275 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333718.1 | 5prime_partial | 153 | 1-462(+) |
Amino Acid sequence : | |||
TQESDVEAAVNAAVKTHGTLDIMYNNAGILESPQFKLLSDFPLSEFNRVVGVNLAGVFLGTKHAARVMIPKRRGSIISTATDASVLGGVGAHAYTAAKHGVVGLMKNAAVELGRHGVRVN CVSPYIVATPMSRKFLESSDEGMTDFFYNLKGV* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 11,798.609 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 63.548 | ||
aromaticity | 0.092 | ||
GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.294 | ||
sheet | 0.275 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333718.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
PGIRRGSRRQRRRQNSRNPRHHVQQRRHPRVAAIQAALRLPAVGIQPRRRREPRRRVSGDETRRQGDDPQAAGEHHLDGDRRQRAGRCRRPRVHRGETRRGGADEERRRGAGEARRPREL RLAVHRGYPDVEEILGEQR* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 11,798.609 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 63.548 | ||
aromaticity | 0.092 | ||
GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.294 | ||
sheet | 0.275 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333718.1 | complete | 109 | 377-48(-) |
Amino Acid sequence : | |||
MYGETQFTRTPCLPSSTAAFFISPTTPCFAAVYAWAPTPPSTLASVAVEMMLPRRLGIITLAACFVPRNTPARFTPTTRLNSDSGKSESSLNCGDSRMPALLYMMSRVP* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,798.609 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 63.548 | ||
aromaticity | 0.092 | ||
GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.294 | ||
sheet | 0.275 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333718.1 | 5prime_partial | 163 | 549-58(-) |
Amino Acid sequence : | |||
INQKIQTTHILGFITRQIQLRCRHIIRRQLHSFQVIKEIRHPLIAALQEFPRHRGSHDVRRDAVHADAVPPQLHGGVLHQPHHAVFRRGVRVGADTAQHAGVGRRRDDAPPPLGDHHPGG VFRPQKHAGEVHADDAVEFRQREVGEQLELRRLEDAGVVVHDV* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 11,798.609 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 63.548 | ||
aromaticity | 0.092 | ||
GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.294 | ||
sheet | 0.275 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333718.1 | 5prime_partial | 153 | 1-462(+) |
Amino Acid sequence : | |||
TQESDVEAAVNAAVKTHGTLDIMYNNAGILESPQFKLLSDFPLSEFNRVVGVNLAGVFLGTKHAARVMIPKRRGSIISTATDASVLGGVGAHAYTAAKHGVVGLMKNAAVELGRHGVRVN CVSPYIVATPMSRKFLESSDEGMTDFFYNLKGV* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 11,798.609 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 63.548 | ||
aromaticity | 0.092 | ||
GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.294 | ||
sheet | 0.275 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333718.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
PGIRRGSRRQRRRQNSRNPRHHVQQRRHPRVAAIQAALRLPAVGIQPRRRREPRRRVSGDETRRQGDDPQAAGEHHLDGDRRQRAGRCRRPRVHRGETRRGGADEERRRGAGEARRPREL RLAVHRGYPDVEEILGEQR* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 11,798.609 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 63.548 | ||
aromaticity | 0.092 | ||
GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.294 | ||
sheet | 0.275 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333718.1 | complete | 109 | 377-48(-) |
Amino Acid sequence : | |||
MYGETQFTRTPCLPSSTAAFFISPTTPCFAAVYAWAPTPPSTLASVAVEMMLPRRLGIITLAACFVPRNTPARFTPTTRLNSDSGKSESSLNCGDSRMPALLYMMSRVP* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,798.609 | ||
Theoretical pI: | 9.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 63.548 | ||
aromaticity | 0.092 | ||
GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.294 | ||
sheet | 0.275 |