Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333719.1 | 5prime_partial | 271 | 2-817(+) |
Amino Acid sequence : | |||
VAGPELGLWAQGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLKHAVKNTVSQVAKRTLTMGANGELHPSRFCEKD LIRVVDREYVFAYIDDPCSATYPLMEKLRQVLVDHALDNGDNEKNVSTSIFHKIEAFEEELKALLPKEVESARIAVESGNPAIANRIVECRSYPLYRFIREELGASFLTGEKAISPGEEC DRVFTALSKGLIVDPLLECLHGWNGAPLPIC* | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 30,005.959 | ||
Theoretical pI: | 5.166 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21930 | ||
Instability index: | 39.696 | ||
aromaticity | 0.063 | ||
GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.214 | ||
sheet | 0.328 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333719.1 | 5prime_partial | 271 | 2-817(+) |
Amino Acid sequence : | |||
VAGPELGLWAQGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLKHAVKNTVSQVAKRTLTMGANGELHPSRFCEKD LIRVVDREYVFAYIDDPCSATYPLMEKLRQVLVDHALDNGDNEKNVSTSIFHKIEAFEEELKALLPKEVESARIAVESGNPAIANRIVECRSYPLYRFIREELGASFLTGEKAISPGEEC DRVFTALSKGLIVDPLLECLHGWNGAPLPIC* | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 30,005.959 | ||
Theoretical pI: | 5.166 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21930 | ||
Instability index: | 39.696 | ||
aromaticity | 0.063 | ||
GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.214 | ||
sheet | 0.328 |