Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333722.1 | 5prime_partial | 231 | 1-696(+) |
Amino Acid sequence : | |||
HPHYETSRFQMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRD LCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLVAQQQHEAELAQAANQPLPDDEDEAFD* | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 26,484.731 | ||
Theoretical pI: | 6.538 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27765 | ||
Instability index: | 31.684 | ||
aromaticity | 0.117 | ||
GRAVY | -0.513 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.190 | ||
sheet | 0.216 |