| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333722.1 | 5prime_partial | 231 | 1-696(+) |
Amino Acid sequence : | |||
| HPHYETSRFQMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRD LCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLVAQQQHEAELAQAANQPLPDDEDEAFD* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 26,484.731 | ||
| Theoretical pI: | 6.538 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27765 | ||
| Instability index: | 31.684 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.513 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.190 | ||
| sheet | 0.216 | ||