Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333726.1 | complete | 194 | 71-655(+) |
Amino Acid sequence : | |||
MVKNYPAVSEEYLKAVEKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDQCSKTGGPFGTMRFKEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRP DKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDTPTSRSF* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 21,420.158 | ||
Theoretical pI: | 7.009 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
Instability index: | 38.300 | ||
aromaticity | 0.082 | ||
GRAVY | -0.429 | ||
Secondary Structure Fraction | |||
Helix | 0.263 | ||
turn | 0.253 | ||
sheet | 0.258 |