| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333732.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
| TNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVDLAAQLPTTNPHSHVMLDRILRLLTSYAILECRLKTLPDGGVERLYGLAPVCKFLTKNEDGVSMAP LTLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVE HVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKF | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 30,060.333 | ||
| Theoretical pI: | 5.435 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
| Instability index: | 29.566 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.242 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333732.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
| TNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVDLAAQLPTTNPHSHVMLDRILRLLTSYAILECRLKTLPDGGVERLYGLAPVCKFLTKNEDGVSMAP LTLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVE HVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKF | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 30,060.333 | ||
| Theoretical pI: | 5.435 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
| Instability index: | 29.566 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.242 | ||
| sheet | 0.264 | ||