| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333739.1 | 5prime_partial | 217 | 1-654(+) |
Amino Acid sequence : | |||
| VEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSV VASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGNFRYQKTAAYGHFGRDDPDFTWETVKILKPKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 23,682.755 | ||
| Theoretical pI: | 8.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 8.524 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.215 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.230 | ||
| sheet | 0.180 | ||