Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333739.1 | 5prime_partial | 217 | 1-654(+) |
Amino Acid sequence : | |||
VEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSV VASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGNFRYQKTAAYGHFGRDDPDFTWETVKILKPKA* | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 23,682.755 | ||
Theoretical pI: | 8.859 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 8.524 | ||
aromaticity | 0.088 | ||
GRAVY | -0.215 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.230 | ||
sheet | 0.180 |