| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333745.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
| KFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTI QQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAVAGGKVDFRFLPFGMGRR SCPGIILALPILGLIIARLV | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 29,728.851 | ||
| Theoretical pI: | 6.678 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45045 | ||
| Instability index: | 58.513 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.227 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333745.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
| KFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTI QQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAVAGGKVDFRFLPFGMGRR SCPGIILALPILGLIIARLV | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 29,728.851 | ||
| Theoretical pI: | 6.678 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45045 | ||
| Instability index: | 58.513 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.227 | ||
| sheet | 0.292 | ||