Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333767.1 | complete | 214 | 70-714(+) |
Amino Acid sequence : | |||
MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSDTGIKYIPSNTFSYYDQVLDTTAMLGAVPLRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI VPELGPDVKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDL* | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 23,860.196 | ||
Theoretical pI: | 5.669 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 43890 | ||
Instability index: | 26.040 | ||
aromaticity | 0.121 | ||
GRAVY | -0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.229 | ||
sheet | 0.285 |