| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333771.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| GLDTSVNGPGVKHVLKSSLDDDKNDYYALGTYDPIKNKWIPDYPEIDVGIGLRYDYGKYYASKTFYDQNRKRRILWGWISETDAEAVDLLKGWSGLQTIPRTITFDKKMGNDILQWPIEE VESLRTSGIEFDDIELPPGSIVPLTVDLGSQLDVVATFEIDEEALEAVVEADINYNCTTSGGAANRGVLGPFGVVVLAEETLSELTPIYFYIIKGSNGQIQTHFCADELRSSKALDVDKI VYGSKVPVLDXRKLS | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,224.406 | ||
| Theoretical pI: | 4.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46995 | ||
| Instability index: | 43.936 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.251 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.236 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333771.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| GLDTSVNGPGVKHVLKSSLDDDKNDYYALGTYDPIKNKWIPDYPEIDVGIGLRYDYGKYYASKTFYDQNRKRRILWGWISETDAEAVDLLKGWSGLQTIPRTITFDKKMGNDILQWPIEE VESLRTSGIEFDDIELPPGSIVPLTVDLGSQLDVVATFEIDEEALEAVVEADINYNCTTSGGAANRGVLGPFGVVVLAEETLSELTPIYFYIIKGSNGQIQTHFCADELRSSKALDVDKI VYGSKVPVLDXRKLS | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,224.406 | ||
| Theoretical pI: | 4.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46995 | ||
| Instability index: | 43.936 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.251 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.236 | ||
| sheet | 0.217 | ||