| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333779.1 | internal | 258 | 3-776(+) |
Amino Acid sequence : | |||
| IVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKL QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA GITVILIDEAALREGLPL | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 12,329.253 | ||
| Theoretical pI: | 11.255 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 109.560 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.283 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.287 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333779.1 | complete | 108 | 175-501(+) |
Amino Acid sequence : | |||
| MSVPDLMLSRRSLTFRSCLPLLLVHSHRLWSSEECAVNSRPTRSPRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTLESNCLVLPSQQMAGCNPTGLAV* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,329.253 | ||
| Theoretical pI: | 11.255 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 109.560 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.283 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.287 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333779.1 | internal | 258 | 3-776(+) |
Amino Acid sequence : | |||
| IVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKL QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA GITVILIDEAALREGLPL | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 12,329.253 | ||
| Theoretical pI: | 11.255 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 109.560 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.283 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.287 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333779.1 | complete | 108 | 175-501(+) |
Amino Acid sequence : | |||
| MSVPDLMLSRRSLTFRSCLPLLLVHSHRLWSSEECAVNSRPTRSPRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTLESNCLVLPSQQMAGCNPTGLAV* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,329.253 | ||
| Theoretical pI: | 11.255 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 109.560 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.283 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.287 | ||
| sheet | 0.278 | ||