Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333799.1 | 5prime_partial | 238 | 815-99(-) |
Amino Acid sequence : | |||
IDLAACRRRGVRVTSTGDCLSDDVADYAVGLAIDVLRRVSAANRFVRAGSWLEQKGFGLGSKVSGKRVGIVGLGKIGSKVAKRFEAFNCSIAYNSTKPKPDVSYTFYADLTDLASNSDIL IVCCSLTAHTRHLINKDVMAALGSKGIIVNVGRGELVDEKEMVDLLVRGEIGGAGLDVFEHEPHVPTQLFGLDNVVLSPHRGVFTPESFAAIEEVVCYNIGAFFSNQPLRNEVEISDL* | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 11,707.169 | ||
Theoretical pI: | 5.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 52.991 | ||
aromaticity | 0.029 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.190 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333799.1 | complete | 108 | 666-340(-) |
Amino Acid sequence : | |||
MARTERVWARFKGEWKTSRNSWTRQNRIEGSKEIRGIQLQHRLQLNKAEARRFLHLLRRPYRSRIQLRHSDRLLLAHRPHAPPHQQGCHGGAREQGYNRQCRARGARR* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,707.169 | ||
Theoretical pI: | 5.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 52.991 | ||
aromaticity | 0.029 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.190 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333799.1 | complete | 105 | 216-533(+) |
Amino Acid sequence : | |||
MRRQYHIIQSKQLCRNVRLVLEHIQTSPADLSSHQQIDHLLLIDELPAPYIDDYTLAPERRHDILVDEVARVGGERAADDQNVGVGCEIGKVGVEGVGNVGLRLC* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,707.169 | ||
Theoretical pI: | 5.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 52.991 | ||
aromaticity | 0.029 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.190 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333799.1 | 5prime_partial | 238 | 815-99(-) |
Amino Acid sequence : | |||
IDLAACRRRGVRVTSTGDCLSDDVADYAVGLAIDVLRRVSAANRFVRAGSWLEQKGFGLGSKVSGKRVGIVGLGKIGSKVAKRFEAFNCSIAYNSTKPKPDVSYTFYADLTDLASNSDIL IVCCSLTAHTRHLINKDVMAALGSKGIIVNVGRGELVDEKEMVDLLVRGEIGGAGLDVFEHEPHVPTQLFGLDNVVLSPHRGVFTPESFAAIEEVVCYNIGAFFSNQPLRNEVEISDL* | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 11,707.169 | ||
Theoretical pI: | 5.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 52.991 | ||
aromaticity | 0.029 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.190 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333799.1 | complete | 108 | 666-340(-) |
Amino Acid sequence : | |||
MARTERVWARFKGEWKTSRNSWTRQNRIEGSKEIRGIQLQHRLQLNKAEARRFLHLLRRPYRSRIQLRHSDRLLLAHRPHAPPHQQGCHGGAREQGYNRQCRARGARR* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,707.169 | ||
Theoretical pI: | 5.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 52.991 | ||
aromaticity | 0.029 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.190 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333799.1 | complete | 105 | 216-533(+) |
Amino Acid sequence : | |||
MRRQYHIIQSKQLCRNVRLVLEHIQTSPADLSSHQQIDHLLLIDELPAPYIDDYTLAPERRHDILVDEVARVGGERAADDQNVGVGCEIGKVGVEGVGNVGLRLC* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,707.169 | ||
Theoretical pI: | 5.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 52.991 | ||
aromaticity | 0.029 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.190 | ||
sheet | 0.248 |