Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333807.1	complete	127	56-439(+)
Amino Acid sequence :
MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPRAEFGTR GIGWSQG*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		12,015.862
Theoretical pI:		11.255
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11250
Instability index:		112.367
aromaticity		0.058
GRAVY		-0.388
Secondary Structure Fraction
Helix		0.250
turn		0.279
sheet		0.260

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333807.1	3prime_partial	104	562-873(+)
Amino Acid sequence :
MSVPDLMLSRRSLTFRSCLPLLLVHSHRLWSSEECAVNSRPTRSPRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTFGEHCLVLPSQQMAGCNPT
Physicochemical properties
Number of amino acids:		104
Molecular weight:		12,015.862
Theoretical pI:		11.255
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11250
Instability index:		112.367
aromaticity		0.058
GRAVY		-0.388
Secondary Structure Fraction
Helix		0.250
turn		0.279
sheet		0.260