Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333813.1	complete	235	1-708(+)
Amino Acid sequence :
MIQQMQHPCNECKGTGETINDKDRCPQCKGEKVVQEKKVLEVIVEKGMQHGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLTLTEALCGFQFILTHLDGRQLLIK SERGEVIKPDQSKAINDEGMPMYQRSFMKGKLYIQFNVEFPDSLSPDQCKALEAVLPPRPTTKVTDMELDECEETTLHDVNMEEEMRRKQQQAQEAYDEDDDMPGGAQRVQCAQQ*
Physicochemical properties
Number of amino acids:		235
Molecular weight:		26,816.127
Theoretical pI:		4.878
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4970
Instability index:		35.864
aromaticity		0.051
GRAVY		-0.780
Secondary Structure Fraction
Helix		0.226
turn		0.162
sheet		0.264