| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333843.1 | internal | 265 | 3-797(+) |
Amino Acid sequence : | |||
| SLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHL TKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFH LNPSGRFVIGGPHGDAGLTGRKIII | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 28,950.489 | ||
| Theoretical pI: | 5.243 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 31.333 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.215 | ||
| sheet | 0.208 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333843.1 | internal | 265 | 3-797(+) |
Amino Acid sequence : | |||
| SLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHL TKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFH LNPSGRFVIGGPHGDAGLTGRKIII | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 28,950.489 | ||
| Theoretical pI: | 5.243 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 31.333 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.215 | ||
| sheet | 0.208 | ||