| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333845.1 | 5prime_partial | 198 | 1-597(+) |
Amino Acid sequence : | |||
| LWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAV AGGKVDFRFLPFGMGRRSCPGIILALPILGLIIARLVSNFEIMPPAGLREVDVSEKGGQFSLHIANHSTIVFKPIEAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 12,683.613 | ||
| Theoretical pI: | 10.429 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 33.949 | ||
| aromaticity | 0.067 | ||
| GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.361 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333845.1 | complete | 119 | 584-225(-) |
Amino Acid sequence : | |||
| MGLKTIVEWLAMCRLNCPPFSLTSTSLNPAGGIISKFETSLAMIRPRMGSARIIPGQLLLPIPNGKNLKSTLPPATAASVPLSSSMNRSGRNSSGFFHHSGLLDSHHAFTTTFDSFGIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,683.613 | ||
| Theoretical pI: | 10.429 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 33.949 | ||
| aromaticity | 0.067 | ||
| GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.361 | ||
| sheet | 0.244 | ||