| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333853.1 | 5prime_partial | 233 | 3-704(+) |
Amino Acid sequence : | |||
| TPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGD MFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPASTGKVMIVDAIINEDGEGDEFSGARLSLDMIMLAVMAQGKERTYKEWVHLLNEAGFSKHTVKNIKSIESVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 18,462.805 | ||
| Theoretical pI: | 11.853 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 90.803 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.773 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.222 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333853.1 | complete | 153 | 623-162(-) |
Amino Acid sequence : | |||
| MHPFLISSLLSLRHHRQHYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLH QSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 18,462.805 | ||
| Theoretical pI: | 11.853 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 90.803 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.773 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.222 | ||
| sheet | 0.137 | ||