| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333861.1 | 3prime_partial | 284 | 1-852(+) |
Amino Acid sequence : | |||
| MAVRPLQFFVLRHHPYHSSPPSLLRRLPYQNTHHYHQKEEKQPPPPPPDLASISRRSLLETMSQKIGKAIRRPGAPSKARVYSDVNVIRPKEYSDYESLTVQWGEQDDYEVVRKVGRGKY SEVFEGVHVTNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQQSKTPSLIFEHVNNTDFKVLYPTLSDFDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHEHRK LRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLGDLXDYDYSLD | |||
Physicochemical properties | |||
| Number of amino acids: | 284 | ||
| Molecular weight: | 15,405.787 | ||
| Theoretical pI: | 8.977 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 41.417 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.252 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333861.1 | complete | 135 | 555-148(-) |
Amino Acid sequence : | |||
| MLKYKTWGLRLLIPNNIKQLHNIRPPTEILQNLDLSLDLLFLDWFKDFDDAFLVIGDVNTLKNFAIFSPSNLPHHLIVILLPPLNSQRLVVRVLLGADDINVGIHPRLGRCSRPPNRFPD LLRHRFEQGAAADGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,405.787 | ||
| Theoretical pI: | 8.977 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 41.417 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.252 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333861.1 | 3prime_partial | 284 | 1-852(+) |
Amino Acid sequence : | |||
| MAVRPLQFFVLRHHPYHSSPPSLLRRLPYQNTHHYHQKEEKQPPPPPPDLASISRRSLLETMSQKIGKAIRRPGAPSKARVYSDVNVIRPKEYSDYESLTVQWGEQDDYEVVRKVGRGKY SEVFEGVHVTNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQQSKTPSLIFEHVNNTDFKVLYPTLSDFDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHEHRK LRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLGDLXDYDYSLD | |||
Physicochemical properties | |||
| Number of amino acids: | 284 | ||
| Molecular weight: | 15,405.787 | ||
| Theoretical pI: | 8.977 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 41.417 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.252 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333861.1 | complete | 135 | 555-148(-) |
Amino Acid sequence : | |||
| MLKYKTWGLRLLIPNNIKQLHNIRPPTEILQNLDLSLDLLFLDWFKDFDDAFLVIGDVNTLKNFAIFSPSNLPHHLIVILLPPLNSQRLVVRVLLGADDINVGIHPRLGRCSRPPNRFPD LLRHRFEQGAAADGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,405.787 | ||
| Theoretical pI: | 8.977 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 41.417 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.393 | ||
| turn | 0.252 | ||
| sheet | 0.252 | ||