| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333878.1 | internal | 287 | 3-863(+) |
Amino Acid sequence : | |||
| LVWLGFGSVVGSGIFSITGQEAHDHAGPAVVVSYAVSGVSALLSVFCYTEFAVEIPVAGGSFSFLRIELGDFIAFIAAGNILLEGLVGAAGLGRSWSSYLASMISSDPNFLRFKIDSFAE GFNLLDPLALVVMWVINGIAMAGTKHTSVLNWVSSVFTSVVIVFIIIFGFIHSKAENLTPFFPYGSEGVFTAAAIVYWSYTGFDMVANMAEEVKNPSRDIAIGLVGSMSLIAVIYCLMSL VLVMMVKYTEIDRNAPYSLVFEQMNMNWAKYLVSIVAIKGMTTSMLV | |||
Physicochemical properties | |||
| Number of amino acids: | 287 | ||
| Molecular weight: | 10,149.171 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 109.025 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.175 | ||
| turn | 0.553 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333878.1 | complete | 118 | 499-143(-) |
Amino Acid sequence : | |||
| MMKTITTEVKTELTQFKTEVCLVPAMAIPLMTHITTRANGSNKLKPSAKESILNLKKLGSLLIMLARYDDQERPNPAAPTRPSSKIFPAAMKAMKSPNSIRRKEKDPPATGISTANSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 10,149.171 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 109.025 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.175 | ||
| turn | 0.553 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333878.1 | 5prime_partial | 103 | 1-312(+) |
Amino Acid sequence : | |||
| TSSGSASAPSSAPASSASPARKPTTTPAPPSSSPTPSPASPRSSPSSATPNSPSRFLLLVGLSPSSGLNWGISSLSSPPGISCWRASLAPPDWGVLGRRILQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,149.171 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 109.025 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.175 | ||
| turn | 0.553 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333878.1 | internal | 287 | 3-863(+) |
Amino Acid sequence : | |||
| LVWLGFGSVVGSGIFSITGQEAHDHAGPAVVVSYAVSGVSALLSVFCYTEFAVEIPVAGGSFSFLRIELGDFIAFIAAGNILLEGLVGAAGLGRSWSSYLASMISSDPNFLRFKIDSFAE GFNLLDPLALVVMWVINGIAMAGTKHTSVLNWVSSVFTSVVIVFIIIFGFIHSKAENLTPFFPYGSEGVFTAAAIVYWSYTGFDMVANMAEEVKNPSRDIAIGLVGSMSLIAVIYCLMSL VLVMMVKYTEIDRNAPYSLVFEQMNMNWAKYLVSIVAIKGMTTSMLV | |||
Physicochemical properties | |||
| Number of amino acids: | 287 | ||
| Molecular weight: | 10,149.171 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 109.025 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.175 | ||
| turn | 0.553 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333878.1 | complete | 118 | 499-143(-) |
Amino Acid sequence : | |||
| MMKTITTEVKTELTQFKTEVCLVPAMAIPLMTHITTRANGSNKLKPSAKESILNLKKLGSLLIMLARYDDQERPNPAAPTRPSSKIFPAAMKAMKSPNSIRRKEKDPPATGISTANSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 10,149.171 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 109.025 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.175 | ||
| turn | 0.553 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333878.1 | 5prime_partial | 103 | 1-312(+) |
Amino Acid sequence : | |||
| TSSGSASAPSSAPASSASPARKPTTTPAPPSSSPTPSPASPRSSPSSATPNSPSRFLLLVGLSPSSGLNWGISSLSSPPGISCWRASLAPPDWGVLGRRILQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,149.171 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 109.025 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.175 | ||
| turn | 0.553 | ||
| sheet | 0.204 | ||