| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333880.1 | internal | 254 | 3-764(+) |
Amino Acid sequence : | |||
| RTPPDSPAGSNAVVSPSKEFRDFRMSDFNINGSPHAFDTQSEYGAESVFSGDKRFDEPSWGTFDSHYDADATWDSISVASKETGSLFGPDDWGLNPIKTGSRGTDASLPKQGPFFDSVPS TPSNAFVPNQGPFFDSVPSTPSNTSFQKQGPFFDSVPSTPLYNLSSQSDNLFAQSSSQYAFADSVPSTPMYNFSSSPKKFSEGSEDQHSFDSFSRFDSFNMNDSGPFSSRESFTRFDSMR STRDSTDFDQGYFA | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 27,874.373 | ||
| Theoretical pI: | 4.361 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 67.578 | ||
| aromaticity | 0.150 | ||
| GRAVY | -0.786 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.398 | ||
| sheet | 0.122 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333880.1 | internal | 254 | 3-764(+) |
Amino Acid sequence : | |||
| RTPPDSPAGSNAVVSPSKEFRDFRMSDFNINGSPHAFDTQSEYGAESVFSGDKRFDEPSWGTFDSHYDADATWDSISVASKETGSLFGPDDWGLNPIKTGSRGTDASLPKQGPFFDSVPS TPSNAFVPNQGPFFDSVPSTPSNTSFQKQGPFFDSVPSTPLYNLSSQSDNLFAQSSSQYAFADSVPSTPMYNFSSSPKKFSEGSEDQHSFDSFSRFDSFNMNDSGPFSSRESFTRFDSMR STRDSTDFDQGYFA | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 27,874.373 | ||
| Theoretical pI: | 4.361 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 67.578 | ||
| aromaticity | 0.150 | ||
| GRAVY | -0.786 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.398 | ||
| sheet | 0.122 | ||