Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333884.1 | internal | 268 | 3-806(+) |
Amino Acid sequence : | |||
RDGDRVTQGLGAVWSLILSRPIVRQASLDIALKCTVHAKDDVQAKAIRLVSNKLYAVDYISESIEQFATNMFLSAISQHSSDSLLSESADSDRRIGGQVESAETSTSGSQFSELGISQNE TAKAVQDASLEDPSSIFSQSHRLMSLFFALCAKKPILLKLVFDSYSRASKAAKQAIHRHIHVLMRALGPSYSELLHIISNPPHGSEELLTQVLNLLSEGRAPPPDLVATVKHLYETRFKD ATILIPILSAFSRDEVLPIFPRLVQLPL | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 29,429.296 | ||
Theoretical pI: | 6.539 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 47.068 | ||
aromaticity | 0.060 | ||
GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.239 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333884.1 | internal | 268 | 3-806(+) |
Amino Acid sequence : | |||
RDGDRVTQGLGAVWSLILSRPIVRQASLDIALKCTVHAKDDVQAKAIRLVSNKLYAVDYISESIEQFATNMFLSAISQHSSDSLLSESADSDRRIGGQVESAETSTSGSQFSELGISQNE TAKAVQDASLEDPSSIFSQSHRLMSLFFALCAKKPILLKLVFDSYSRASKAAKQAIHRHIHVLMRALGPSYSELLHIISNPPHGSEELLTQVLNLLSEGRAPPPDLVATVKHLYETRFKD ATILIPILSAFSRDEVLPIFPRLVQLPL | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 29,429.296 | ||
Theoretical pI: | 6.539 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 47.068 | ||
aromaticity | 0.060 | ||
GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.239 | ||
sheet | 0.287 |