| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333888.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| IRFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEALNAEEAFKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIALYEANILAVLSEVMSAIFAEV MNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSVYVKAAQKLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRTATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNAR LAIAXIGKLLFAQFSELVNDF | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 12,704.641 | ||
| Theoretical pI: | 9.876 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 99.055 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.433 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333888.1 | 5prime_partial | 120 | 2-364(+) |
Amino Acid sequence : | |||
| SDSRSWKPSPNSSTTTSLPACLSAAPSPPPAISSPYPTSPAFSPAAPTPRPLAPPEKPSMPRKPSSLPASTEASLSSSPKKAWPLSTAPQLALDWPPLLCMRPIFLLFCPKLCRPFSQKL * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,704.641 | ||
| Theoretical pI: | 9.876 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 99.055 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.433 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333888.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| IRFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEALNAEEAFKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIALYEANILAVLSEVMSAIFAEV MNGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSVYVKAAQKLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRTATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNAR LAIAXIGKLLFAQFSELVNDF | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 12,704.641 | ||
| Theoretical pI: | 9.876 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 99.055 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.433 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333888.1 | 5prime_partial | 120 | 2-364(+) |
Amino Acid sequence : | |||
| SDSRSWKPSPNSSTTTSLPACLSAAPSPPPAISSPYPTSPAFSPAAPTPRPLAPPEKPSMPRKPSSLPASTEASLSSSPKKAWPLSTAPQLALDWPPLLCMRPIFLLFCPKLCRPFSQKL * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,704.641 | ||
| Theoretical pI: | 9.876 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 99.055 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.433 | ||
| sheet | 0.258 | ||