| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333894.1 | complete | 208 | 746-120(-) |
Amino Acid sequence : | |||
| MVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELVAKFEGLCKVIKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPEN SIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDDDAADADVDMPALEEADADAEGSKMEEVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 13,384.073 | ||
| Theoretical pI: | 10.266 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 54.283 | ||
| aromaticity | 0.150 | ||
| GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.350 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333894.1 | complete | 121 | 466-831(+) |
Amino Acid sequence : | |||
| MILSMLAVHPYSPVTRQQGESTTRSETTTFSTLSPRTSLMTLHRPSNLATSSSFFFFSSSLSSSFKPSLVAETSFFPSNSFNWPIAYSSIASTMKRTSYPFFLSFLRKGEFSTAFLLSPX M* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,384.073 | ||
| Theoretical pI: | 10.266 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 54.283 | ||
| aromaticity | 0.150 | ||
| GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.350 | ||
| sheet | 0.225 | ||