| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333895.1 | internal | 265 | 795-1(-) |
Amino Acid sequence : | |||
| RLIILSLSLWXLIGLVKMAEDGYKVSLNVYDLSQGLARQLSTTFLGKAIEAIWHTGIVVYGREYYFGGGIQNAPAGTTPYGKPIRVVDLGTTHVPKDVFEQYLKEISPRYTAETYSLLTH NCNNFSNEVAQFLVGAQIPEYILNLPNEVLSSPMGALILPMIQQLESTLRAGAVPQAPQFRPSAAVSSNQTKTAEGGSAQSSKSKNEDASKNRAVESSSSAEEKHSSKGAAGDPLGDARS RVQEEISSEFAAIMASGTLRASEAA | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 28,326.572 | ||
| Theoretical pI: | 5.878 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
| Instability index: | 46.050 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.191 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.284 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333895.1 | internal | 265 | 795-1(-) |
Amino Acid sequence : | |||
| RLIILSLSLWXLIGLVKMAEDGYKVSLNVYDLSQGLARQLSTTFLGKAIEAIWHTGIVVYGREYYFGGGIQNAPAGTTPYGKPIRVVDLGTTHVPKDVFEQYLKEISPRYTAETYSLLTH NCNNFSNEVAQFLVGAQIPEYILNLPNEVLSSPMGALILPMIQQLESTLRAGAVPQAPQFRPSAAVSSNQTKTAEGGSAQSSKSKNEDASKNRAVESSSSAEEKHSSKGAAGDPLGDARS RVQEEISSEFAAIMASGTLRASEAA | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 28,326.572 | ||
| Theoretical pI: | 5.878 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
| Instability index: | 46.050 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.191 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.284 | ||
| sheet | 0.292 | ||