| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333919.1 | internal | 265 | 1-795(+) |
Amino Acid sequence : | |||
| VQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYL KSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDD KCIEILKKCKEAIPASTGKVMIVDA | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 10,862.233 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.170 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.390 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333919.1 | complete | 125 | 411-34(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 10,862.233 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.170 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.390 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333919.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| STSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLSQ VDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 10,862.233 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.170 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.390 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333919.1 | 5prime_partial | 114 | 795-451(-) |
Amino Acid sequence : | |||
| SIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 10,862.233 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.170 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.390 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333919.1 | 5prime_partial | 105 | 794-477(-) |
Amino Acid sequence : | |||
| ASTIITFPVLAGIASLHFFRISMHLSSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTDRNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 10,862.233 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.170 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.390 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333919.1 | internal | 265 | 1-795(+) |
Amino Acid sequence : | |||
| VQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYL KSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDD KCIEILKKCKEAIPASTGKVMIVDA | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 10,862.233 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.170 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.390 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333919.1 | complete | 125 | 411-34(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 10,862.233 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.170 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.390 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333919.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| STSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLSQ VDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 10,862.233 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.170 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.390 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333919.1 | 5prime_partial | 114 | 795-451(-) |
Amino Acid sequence : | |||
| SIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 10,862.233 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.170 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.390 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333919.1 | 5prime_partial | 105 | 794-477(-) |
Amino Acid sequence : | |||
| ASTIITFPVLAGIASLHFFRISMHLSSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTDRNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 10,862.233 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 61.170 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.390 | ||
| sheet | 0.219 | ||