Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333922.1	3prime_partial	278	3-836(+)
Amino Acid sequence :
MADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG AGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYDNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKYLDEKTIFHLNPSGRFV IGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTK
Physicochemical properties
Number of amino acids:		278
Molecular weight:		13,155.505
Theoretical pI:		4.051
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		25.086
aromaticity		0.008
GRAVY		0.016
Secondary Structure Fraction
Helix		0.318
turn		0.264
sheet		0.240

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333922.1	3prime_partial	143	431-3(-)
Amino Acid sequence :
MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRH
Physicochemical properties
Number of amino acids:		143
Molecular weight:		13,155.505
Theoretical pI:		4.051
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		25.086
aromaticity		0.008
GRAVY		0.016
Secondary Structure Fraction
Helix		0.318
turn		0.264
sheet		0.240

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333922.1	5prime_partial	129	836-447(-)
Amino Acid sequence :
LGGVLPGEGPAAVGPPPAVGVDDDLTAGETRVAVGPTDDETPGGIKVEDGFLVQILRGDHRLDDVLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPVGSQPGARTV LADLRQTSA*
Physicochemical properties
Number of amino acids:		129
Molecular weight:		13,155.505
Theoretical pI:		4.051
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		25.086
aromaticity		0.008
GRAVY		0.016
Secondary Structure Fraction
Helix		0.318
turn		0.264
sheet		0.240

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333922.1	3prime_partial	278	3-836(+)
Amino Acid sequence :
MADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG AGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYDNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKYLDEKTIFHLNPSGRFV IGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTK
Physicochemical properties
Number of amino acids:		278
Molecular weight:		13,155.505
Theoretical pI:		4.051
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		25.086
aromaticity		0.008
GRAVY		0.016
Secondary Structure Fraction
Helix		0.318
turn		0.264
sheet		0.240

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333922.1	3prime_partial	143	431-3(-)
Amino Acid sequence :
MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRH
Physicochemical properties
Number of amino acids:		143
Molecular weight:		13,155.505
Theoretical pI:		4.051
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		25.086
aromaticity		0.008
GRAVY		0.016
Secondary Structure Fraction
Helix		0.318
turn		0.264
sheet		0.240

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333922.1	5prime_partial	129	836-447(-)
Amino Acid sequence :
LGGVLPGEGPAAVGPPPAVGVDDDLTAGETRVAVGPTDDETPGGIKVEDGFLVQILRGDHRLDDVLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPVGSQPGARTV LADLRQTSA*
Physicochemical properties
Number of amino acids:		129
Molecular weight:		13,155.505
Theoretical pI:		4.051
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		25.086
aromaticity		0.008
GRAVY		0.016
Secondary Structure Fraction
Helix		0.318
turn		0.264
sheet		0.240