| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333924.1 | internal | 225 | 675-1(-) |
Amino Acid sequence : | |||
| AGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPK ADAVMLMVLHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFSGARLSLDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 24,554.958 | ||
| Theoretical pI: | 5.547 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 18.906 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.218 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333924.1 | internal | 225 | 675-1(-) |
Amino Acid sequence : | |||
| AGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPK ADAVMLMVLHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFSGARLSLDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 24,554.958 | ||
| Theoretical pI: | 5.547 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 18.906 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.218 | ||
| sheet | 0.293 | ||