Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333925.1	internal	295	1-885(+)
Amino Acid sequence :
DKEVELHAQAWDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTP LYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMVLHDWS DDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEVSGARLSLDMTMMAMTTS
Physicochemical properties
Number of amino acids:		295
Molecular weight:		14,297.977
Theoretical pI:		11.452
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		74.746
aromaticity		0.048
GRAVY		-0.813
Secondary Structure Fraction
Helix		0.248
turn		0.192
sheet		0.240

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333925.1	5prime_partial	133	887-486(-)
Amino Acid sequence :
PDVVIAIIVISNDKRAPETSSPSPSSLIIASTIITFPVLVGIASLHFFRISMHLSSLQSCNTMSMTASAFGRLSNMSPPTKSTPLRGGASATTSGRSNAIPRTHGNASTSFPIAIPWRPP TSTTDRTPLNAVG*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		14,297.977
Theoretical pI:		11.452
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		74.746
aromaticity		0.048
GRAVY		-0.813
Secondary Structure Fraction
Helix		0.248
turn		0.192
sheet		0.240

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333925.1	complete	125	420-43(-)
Amino Acid sequence :
MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEDEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVRNLQLHRRRQRR GGDVT*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,297.977
Theoretical pI:		11.452
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		74.746
aromaticity		0.048
GRAVY		-0.813
Secondary Structure Fraction
Helix		0.248
turn		0.192
sheet		0.240

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333925.1	internal	295	1-885(+)
Amino Acid sequence :
DKEVELHAQAWDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTP LYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMVLHDWS DDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEVSGARLSLDMTMMAMTTS
Physicochemical properties
Number of amino acids:		295
Molecular weight:		14,297.977
Theoretical pI:		11.452
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		74.746
aromaticity		0.048
GRAVY		-0.813
Secondary Structure Fraction
Helix		0.248
turn		0.192
sheet		0.240

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333925.1	5prime_partial	133	887-486(-)
Amino Acid sequence :
PDVVIAIIVISNDKRAPETSSPSPSSLIIASTIITFPVLVGIASLHFFRISMHLSSLQSCNTMSMTASAFGRLSNMSPPTKSTPLRGGASATTSGRSNAIPRTHGNASTSFPIAIPWRPP TSTTDRTPLNAVG*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		14,297.977
Theoretical pI:		11.452
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		74.746
aromaticity		0.048
GRAVY		-0.813
Secondary Structure Fraction
Helix		0.248
turn		0.192
sheet		0.240

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333925.1	complete	125	420-43(-)
Amino Acid sequence :
MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEDEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVRNLQLHRRRQRR GGDVT*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,297.977
Theoretical pI:		11.452
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		74.746
aromaticity		0.048
GRAVY		-0.813
Secondary Structure Fraction
Helix		0.248
turn		0.192
sheet		0.240