| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333943.1 | 3prime_partial | 259 | 53-829(+) |
Amino Acid sequence : | |||
| MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVI GGPHGDAGLTGRKIIIDTY | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 12,101.642 | ||
| Theoretical pI: | 4.546 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 40.859 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.224 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333943.1 | 5prime_partial | 107 | 829-506(-) |
Amino Acid sequence : | |||
| ICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,101.642 | ||
| Theoretical pI: | 4.546 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 40.859 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.224 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333943.1 | 3prime_partial | 259 | 53-829(+) |
Amino Acid sequence : | |||
| MDSFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVI GGPHGDAGLTGRKIIIDTY | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 12,101.642 | ||
| Theoretical pI: | 4.546 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 40.859 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.224 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333943.1 | 5prime_partial | 107 | 829-506(-) |
Amino Acid sequence : | |||
| ICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,101.642 | ||
| Theoretical pI: | 4.546 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 40.859 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.224 | ||
| sheet | 0.224 | ||