| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333950.1 | 5prime_partial | 143 | 3-434(+) |
Amino Acid sequence : | |||
| HSRNGEASPSPPPHCRRSGGGAPPQPHRGCRRRLQLDSGEHSVDLPRIDRGVHGGRPRRIRAGLGEQPAHISHHQVHQLRCAAGEQRAVLASRRVVLQLPAWRRGKSLLAVVLRRHTVPE LVPPIISNYFCLFRVLNFTYICS* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 12,897.385 | ||
| Theoretical pI: | 6.737 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 49.819 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.273 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333950.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
| TIHEMAKPHHLRLLIAAVAAAALLLSLTVDAGGDFSWIPVSTPSTCQGSIAECMAEGRGEFELDSESNRRILATTKYISYGALQANNVPCSRRGASYYNCQPGAEANPYSRSCSAATQCR S* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 12,897.385 | ||
| Theoretical pI: | 6.737 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 49.819 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.273 | ||
| sheet | 0.306 | ||