| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333958.1 | 5prime_partial | 178 | 782-246(-) |
Amino Acid sequence : | |||
| PNILMLRPADGNETAGSYKVAVLNRKRPSVLALSRQKLPQLPGTSIEGVEKGGYTISDNSSGNKPDVILIGTGSELEIAAKAADELRKEGKAVRVVSLVSWELFDEQSDEYKESVFPAAV TARVSIEAGTTFGWGKIVGSKGKAIGIDRFGASAPAGKIYKEFGITAEAVVAAAKALL* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 13,610.416 | ||
| Theoretical pI: | 4.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 60.329 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.372 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333958.1 | complete | 129 | 289-678(+) |
Amino Acid sequence : | |||
| MPNSLYIFPAGALAPNRSIPMAFPFEPTIFPQPNVVPASMLTLAVTAAGKTLSLYSSDCSSKSSQETRETTLTALPSFLSSSAAFAAISNSEPVPIKMTSGLLPDELSEMVYPPFSTPSM EVPGSWGSF* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,610.416 | ||
| Theoretical pI: | 4.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 60.329 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.372 | ||
| sheet | 0.295 | ||