Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333958.1 | 5prime_partial | 178 | 782-246(-) |
Amino Acid sequence : | |||
PNILMLRPADGNETAGSYKVAVLNRKRPSVLALSRQKLPQLPGTSIEGVEKGGYTISDNSSGNKPDVILIGTGSELEIAAKAADELRKEGKAVRVVSLVSWELFDEQSDEYKESVFPAAV TARVSIEAGTTFGWGKIVGSKGKAIGIDRFGASAPAGKIYKEFGITAEAVVAAAKALL* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 13,610.416 | ||
Theoretical pI: | 4.484 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 60.329 | ||
aromaticity | 0.093 | ||
GRAVY | 0.164 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.372 | ||
sheet | 0.295 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333958.1 | complete | 129 | 289-678(+) |
Amino Acid sequence : | |||
MPNSLYIFPAGALAPNRSIPMAFPFEPTIFPQPNVVPASMLTLAVTAAGKTLSLYSSDCSSKSSQETRETTLTALPSFLSSSAAFAAISNSEPVPIKMTSGLLPDELSEMVYPPFSTPSM EVPGSWGSF* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,610.416 | ||
Theoretical pI: | 4.484 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 60.329 | ||
aromaticity | 0.093 | ||
GRAVY | 0.164 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.372 | ||
sheet | 0.295 |