| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333962.1 | 5prime_partial | 254 | 808-44(-) |
Amino Acid sequence : | |||
| HGGAFFTESPFSPTYHNYLNYVVSKANIVAVSVNYRLAPEYLLPTAYQDCWLALKWVFSHSNGNGNEKWLRDDVDFGHVYLGGDSAGGNIAHNVAMRVGTGKMECDDKGIMVHGLFLNCP HFWGSSRIGNEASFPKVMIETEESIWIHAYPSSSGFDDPASNPGKDPNLGTLGCKKVLVYVAGNDVLKERGLYYAKVLKESGWRGGVKSVEVKGENHVFNLKFPYNRDAREMMGNVALFL NDRLKLSHNMYTSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 22,232.185 | ||
| Theoretical pI: | 11.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 56.070 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.156 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.181 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333962.1 | 5prime_partial | 188 | 2-568(+) |
Amino Acid sequence : | |||
| TNRKPQLIINIWRLLIRCIHVVAQFQSIIEKQSHIPHHLPRISVVRKLEVKHMIFPLHLHTLHTSSPPTLFQHLRIIQPPLFQHIIPCNINQHFFTPQRPKIRILTRVRRRVIKPARAWV CMDPYTLLRLYHHFRKTRFIPNSATSPEMWTVQKQSMDHNTLIITLHLPRPHPHCHVVRDVAAGAVPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 22,232.185 | ||
| Theoretical pI: | 11.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 56.070 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.156 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.181 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333962.1 | 5prime_partial | 254 | 808-44(-) |
Amino Acid sequence : | |||
| HGGAFFTESPFSPTYHNYLNYVVSKANIVAVSVNYRLAPEYLLPTAYQDCWLALKWVFSHSNGNGNEKWLRDDVDFGHVYLGGDSAGGNIAHNVAMRVGTGKMECDDKGIMVHGLFLNCP HFWGSSRIGNEASFPKVMIETEESIWIHAYPSSSGFDDPASNPGKDPNLGTLGCKKVLVYVAGNDVLKERGLYYAKVLKESGWRGGVKSVEVKGENHVFNLKFPYNRDAREMMGNVALFL NDRLKLSHNMYTSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 22,232.185 | ||
| Theoretical pI: | 11.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 56.070 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.156 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.181 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333962.1 | 5prime_partial | 188 | 2-568(+) |
Amino Acid sequence : | |||
| TNRKPQLIINIWRLLIRCIHVVAQFQSIIEKQSHIPHHLPRISVVRKLEVKHMIFPLHLHTLHTSSPPTLFQHLRIIQPPLFQHIIPCNINQHFFTPQRPKIRILTRVRRRVIKPARAWV CMDPYTLLRLYHHFRKTRFIPNSATSPEMWTVQKQSMDHNTLIITLHLPRPHPHCHVVRDVAAGAVPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 22,232.185 | ||
| Theoretical pI: | 11.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 56.070 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.156 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.181 | ||
| sheet | 0.176 | ||