| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333965.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| LVQFAVGSVLVITMWTLNLYKRPKISGAQLAGILPLAVVHTLGNLFTNMSLGKVAVSFTHTIKAMEPFFSVVLSALFLGELPTLWVVSSLLPIVGGVALASMTEASFNWAGFWSAMASNL TNQSRNVLSKKFMVKKEESLDNITLFSIITIMSFFLMAPIAFFVEGFKLTPSYLTASGVNVNQLYTRSLLAALCFHAYQQVSYMILQRVSPVTHSVGNCVKRVVVIVTSVLFFRTPVSPI | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 26,278.909 | ||
| Theoretical pI: | 9.849 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 33.800 | ||
| aromaticity | 0.113 | ||
| GRAVY | 0.750 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.242 | ||
| sheet | 0.271 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333965.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| LVQFAVGSVLVITMWTLNLYKRPKISGAQLAGILPLAVVHTLGNLFTNMSLGKVAVSFTHTIKAMEPFFSVVLSALFLGELPTLWVVSSLLPIVGGVALASMTEASFNWAGFWSAMASNL TNQSRNVLSKKFMVKKEESLDNITLFSIITIMSFFLMAPIAFFVEGFKLTPSYLTASGVNVNQLYTRSLLAALCFHAYQQVSYMILQRVSPVTHSVGNCVKRVVVIVTSVLFFRTPVSPI | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 26,278.909 | ||
| Theoretical pI: | 9.849 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 33.800 | ||
| aromaticity | 0.113 | ||
| GRAVY | 0.750 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.242 | ||
| sheet | 0.271 | ||