Acc_NO	ORF type	length	start-end position (strand +/-)
>DY333968.1	complete	101	475-780(+)
Amino Acid sequence :
MKKAAKELDEVVGEWLAEHREREFSGEGKAQDFMDVMISVVKGADLQCEFDVDTIIKATCGTLIAGGTDTTAVVFVWALSLLLNHSHVLKKAQQELDKHVG*
Physicochemical properties
Number of amino acids:		101
Molecular weight:		11,099.597
Theoretical pI:		5.073
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		1.810
aromaticity		0.059
GRAVY		-0.042
Secondary Structure Fraction
Helix		0.307
turn		0.129
sheet		0.317