| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333971.1 | 5prime_partial | 259 | 3-782(+) |
Amino Acid sequence : | |||
| RLLPQLIFRMETVAACRASFATMSPNWVPRYGPYRPDLRVSSSPVLSNVSIQRKPLSNLKMGNRKVGYLSSRRVATRASMQPSDSGSSEYPIAPLQLESPIGQFLSQILTSHPHLVPAAV EQQLEQLQTDREAENEKEEPPASGTDLVLYRRIAEVKANERKKALEEILYALVVQKFMDASVSLVPAIAPSSSDSLVDIGPSEEDKWERLHSPEAYEMIQNHLSLILGNRVGDPNSAAQI SKLRVGQVYAASVMYGYFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,734.420 | ||
| Theoretical pI: | 7.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
| Instability index: | 56.902 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.278 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333971.1 | 5prime_partial | 259 | 3-782(+) |
Amino Acid sequence : | |||
| RLLPQLIFRMETVAACRASFATMSPNWVPRYGPYRPDLRVSSSPVLSNVSIQRKPLSNLKMGNRKVGYLSSRRVATRASMQPSDSGSSEYPIAPLQLESPIGQFLSQILTSHPHLVPAAV EQQLEQLQTDREAENEKEEPPASGTDLVLYRRIAEVKANERKKALEEILYALVVQKFMDASVSLVPAIAPSSSDSLVDIGPSEEDKWERLHSPEAYEMIQNHLSLILGNRVGDPNSAAQI SKLRVGQVYAASVMYGYFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,734.420 | ||
| Theoretical pI: | 7.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
| Instability index: | 56.902 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.278 | ||
| sheet | 0.293 | ||