Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333987.1 | 5prime_partial | 247 | 787-44(-) |
Amino Acid sequence : | |||
HMKAFTAKGGDVSWHIHDERSLLALQGPLAAPTLQHLTKDDLSKMYFSDFRILDINGVSCFLTRTGYTGEDGFEISVPSEHAVDLAKALLDKSEGKVRLTGLGARDSLRLEAGLCLYGND MEQHTTPVEAGLTWAIGKRRRAEGGFLGAEVILKQIADGPPVRRVGLFSSGPPARSHSEIQNEKGEAIGEVTSGGFSPCLKKNIAMGYVKSGCHKNGTKLKIVVRGKTYDGTITKMPFVP TNYYKPS* | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 13,341.429 | ||
Theoretical pI: | 8.838 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 84.688 | ||
aromaticity | 0.017 | ||
GRAVY | -1.680 | ||
Secondary Structure Fraction | |||
Helix | 0.122 | ||
turn | 0.235 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333987.1 | complete | 115 | 446-99(-) |
Amino Acid sequence : | |||
MPLRERHGATHNTSRSRAHVGHREAKEGRGRVPRGRSDPEADRRRPTREESRALLFGPAREEPQRDSEREGGGHRRSDERRVQPVLEEEHSHGVCEIRVPQEWDKAEDCGQRKDI* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,341.429 | ||
Theoretical pI: | 8.838 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 84.688 | ||
aromaticity | 0.017 | ||
GRAVY | -1.680 | ||
Secondary Structure Fraction | |||
Helix | 0.122 | ||
turn | 0.235 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333987.1 | 5prime_partial | 247 | 787-44(-) |
Amino Acid sequence : | |||
HMKAFTAKGGDVSWHIHDERSLLALQGPLAAPTLQHLTKDDLSKMYFSDFRILDINGVSCFLTRTGYTGEDGFEISVPSEHAVDLAKALLDKSEGKVRLTGLGARDSLRLEAGLCLYGND MEQHTTPVEAGLTWAIGKRRRAEGGFLGAEVILKQIADGPPVRRVGLFSSGPPARSHSEIQNEKGEAIGEVTSGGFSPCLKKNIAMGYVKSGCHKNGTKLKIVVRGKTYDGTITKMPFVP TNYYKPS* | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 13,341.429 | ||
Theoretical pI: | 8.838 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 84.688 | ||
aromaticity | 0.017 | ||
GRAVY | -1.680 | ||
Secondary Structure Fraction | |||
Helix | 0.122 | ||
turn | 0.235 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333987.1 | complete | 115 | 446-99(-) |
Amino Acid sequence : | |||
MPLRERHGATHNTSRSRAHVGHREAKEGRGRVPRGRSDPEADRRRPTREESRALLFGPAREEPQRDSEREGGGHRRSDERRVQPVLEEEHSHGVCEIRVPQEWDKAEDCGQRKDI* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,341.429 | ||
Theoretical pI: | 8.838 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 84.688 | ||
aromaticity | 0.017 | ||
GRAVY | -1.680 | ||
Secondary Structure Fraction | |||
Helix | 0.122 | ||
turn | 0.235 | ||
sheet | 0.252 |