| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY333993.1 | complete | 208 | 117-743(+) |
Amino Acid sequence : | |||
| MVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRC IVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGNFRYQKTAAYGHFGRDDPDFTWETVKILKPKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,748.794 | ||
| Theoretical pI: | 9.097 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 8.275 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.226 | ||
| sheet | 0.178 | ||