Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY333993.1 | complete | 208 | 117-743(+) |
Amino Acid sequence : | |||
MVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRC IVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGNFRYQKTAAYGHFGRDDPDFTWETVKILKPKA* | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 22,748.794 | ||
Theoretical pI: | 9.097 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 8.275 | ||
aromaticity | 0.087 | ||
GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.226 | ||
sheet | 0.178 |