Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY334017.1 | 5prime_partial | 233 | 1-702(+) |
Amino Acid sequence : | |||
ENFNFNMLNLEARSNENVTKSPLSNVIYNMNAVYQNPNIISMGHISGSKYNNIISPPKEPNNMQTNNSSNKDDAMNANSAADKRFKTLPAAETLPKNEVLGGYIFVCNNDTMQEDLKRQL FGLPPRYRDSVRAITPGLPLFLYNYTTHQLHGIFEATTFGGSNIDPTAWEDKKCRGESRFPAQVRIRVRKLCKPLEEDAFRPVLHHYDGPKFRLELSVPETLDLLDLCEQAGV* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 26,365.484 | ||
Theoretical pI: | 6.604 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17670 | ||
Instability index: | 41.868 | ||
aromaticity | 0.086 | ||
GRAVY | -0.592 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.292 | ||
sheet | 0.245 |