| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334019.1 | internal | 292 | 3-878(+) |
Amino Acid sequence : | |||
| TGNPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRS VRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVRQTDY VQRNFDKVKVPFLVLHGTLDGLAEVSGSEMLYQKASSEDKTLKLYEGMYHSL | |||
Physicochemical properties | |||
| Number of amino acids: | 292 | ||
| Molecular weight: | 12,216.981 | ||
| Theoretical pI: | 8.689 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 52.086 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.243 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334019.1 | 5prime_partial | 107 | 878-555(-) |
Amino Acid sequence : | |||
| QRVIHPFIQFQSLVLAAGFLVQHLRPRHFSQPIQGPVQNQEGHLDLVEIPLHVIRLPYQLSHCPNSGLPGVPHRVARDYLQLLRIFDGHPHHLLVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,216.981 | ||
| Theoretical pI: | 8.689 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 52.086 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.243 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334019.1 | internal | 292 | 3-878(+) |
Amino Acid sequence : | |||
| TGNPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRS VRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVRQTDY VQRNFDKVKVPFLVLHGTLDGLAEVSGSEMLYQKASSEDKTLKLYEGMYHSL | |||
Physicochemical properties | |||
| Number of amino acids: | 292 | ||
| Molecular weight: | 12,216.981 | ||
| Theoretical pI: | 8.689 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 52.086 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.243 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY334019.1 | 5prime_partial | 107 | 878-555(-) |
Amino Acid sequence : | |||
| QRVIHPFIQFQSLVLAAGFLVQHLRPRHFSQPIQGPVQNQEGHLDLVEIPLHVIRLPYQLSHCPNSGLPGVPHRVARDYLQLLRIFDGHPHHLLVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,216.981 | ||
| Theoretical pI: | 8.689 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 52.086 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.243 | ||
| sheet | 0.196 | ||